Rich Piana 5% Nutrition Kill It (Mango Pineapple)

1
by on June 30, 2015 at 11:53 am

Rich Piana 5% Nutrition Kill It (Mango Pineapple)

Rich Piana 5% Nutrition Kill It (Mango Pineapple)

  • Delicious flavor
  • 5% nutrition
  • All day you may
  • tastes great
  • 30 servings

Don’t Just Do Your Workout, KILL IT!• Energy to Annihilate Your Workout• Extreme, Insane Pump• Attack the Weights Endurance• Laser Sharp FocusWhen it comes to your pre-workout, you don’t want another product that is overloaded with stimulants and little else – you want a product that will power you through your workouts.Don’t Just Go Through the Motions, Destroy the Weights!KILL IT is that product – it was created to give you the drive to push through your toughest workouts AND cover all

List Price: $ 42.99

Price: $ 42.99

, , , , ,

ProMix Grass Fed Whey Protein – 5lb Bulk Bag

2
by on June 29, 2015 at 8:45 pm

ProMix Grass Fed Whey Protein – 5lb Bulk Bag

ProMix Grass Fed Whey Protein - 5lb Bulk Bag

  • Pure Whey Derived from the Milk of Grass-Fed, Hormone and Antibiotic-Free Cows (certified rBST-free)
  • 20 Grams Cold-Processed Whey Protein per Serving
  • 4.9 Grams of BCAAs, Instanitized to Mix Easily
  • Rich in Naturally Occurring Immuno-globulins, Lactoferrin, CLA’s and Growth Factors
  • 100% Non-GMO Ingredients, No Gluten, No Artificial Flavors, No Added Colors or Sweeteners, BPA-Free

ProMix Whey comes from the milk of grass-fed cows. Cold-processed microfiltration produces a non-denatured whey protein with superior bioavailability and an unsurpassed amino acid profile, rich in naturally occurring immuno-globulins, lactoferrin, CLA’s and growth factors. On training days, mix two scoops in 12-16 oz of water, or carbohydrate based post-workout beverage, within 30 minutes of your workout. On non-training days, use one scoop, 1-3 times daily, in between or in addition to meals as

List Price: $ 99.99

Price: $ 79.99

, , , ,

Garcinia Cambogia Extract – All Natural 100% Pure Appetite Suppresant, Carb Blocker, Diuretic and Weight Loss Supplement Formula Pills to Slim Down and Fulltime Energy

3
by on June 29, 2015 at 10:02 am

Garcinia Cambogia Extract – All Natural 100% Pure Appetite Suppresant, Carb Blocker, Diuretic and Weight Loss Supplement Formula Pills to Slim Down and Fulltime Energy

Garcinia Cambogia Extract - All Natural 100% Pure Appetite Suppresant, Carb Blocker, Diuretic and Weight Loss Supplement Formula Pills to Slim Down and Fulltime Energy

  • BURNS FAT – This Garcinia Cambogia formula contains a 60% concentration of HCA. The potent compound disrupts fat production and activates fat-burning enzymes. Your belly fat diminishes, so your clothes feel looser.
  • RISK-FREE – 100% natural with no fillers or allergens, so you can take this unique formula with confidence. There’s no nausea or nervousness because this formula is stimulant free. In fact, some users experience better quality sleep, which is a positive side effect!
  • CURBS APPETITE – 60% HCA potency suppresses your need to crunch on fat-laden foods. You’ll feel fuller at mealtime and probably leave more food on your plate than you eat!
  • INCREASED ENERGY – Most users report feeling more energetic.You’ll make it through the day without feeling sluggish, which is common with most diets. Added energy helps break through your weight loss plateau and lose those last 10 pounds!
  • EASY TO TAKE – With a smooth coating and no aftertaste, the two small caplets are easy to swallow. With so many benefits, you have nothing to lose, except a few clothing sizes. So go ahead and click “Add to Cart” now while supplies last!

Are you searching for the perfect all natural weight loss supplement? Then look no further! When you get Swoll’s Garcinia Cambogia, you get a premium quality, all natural Garcinia Cambogia. The proprietary formula contains 60% HCA, which is the ideal concentration for weight loss.
The formula’s potent 60% HCA disrupts fat production and ignites fat-burning enzymes. Your body taps into stored fat to burn for energy. Without added exercise, inches begin to melt off your waistline. You can finally

List Price: $ 99.95

Price: $ 99.95

, , , , , , , , , , , , , , , , , , ,

VitaFusion MultiVites Gummy Vitamins for Adults – 250 Gummies

2
by on June 29, 2015 at 5:59 am

VitaFusion MultiVites Gummy Vitamins for Adults – 250 Gummies

VitaFusion MultiVites Gummy Vitamins for Adults - 250 Gummies

  • Multivitamin & mineral supplement specially formulated for adults, 200% vitamin D

VitaFusion Multi Vites Gummy Vitamins for Adults, MultiVites Chewable, 250 Gummies

List Price: $ 29.99

Price: $ 8.60

, , , , ,

ASICS Women’s Circuit 7 Singlet,Red,Medium

2
by on June 28, 2015 at 3:21 pm

ASICS Women’s Circuit 7 Singlet,Red,Medium

ASICS Women's Circuit 7 Singlet,Red,Medium

  • Lightweight breathable knit
  • Screening Instruction D
  • Hydrology Fabric
  • 100% Polyester Knit

Don’t let the casual good looks fool you. This is a performance top, pure and simple. The breathable Hydrology(R) fabric flatters your shape and supports muscles, while also wicking away moisture, letting you be at your best.

List Price: $ 20.00

Price: $ 20.00

in Fitness Gear

, , ,

Ask Me About Menopause Women’s Regular Fit Tee Shirt Large-Red

0
by on June 27, 2015 at 11:59 pm

Ask Me About Menopause Women’s Regular Fit Tee Shirt Large-Red

Ask Me About Menopause Women's Regular Fit Tee Shirt Large-Red

  • Machine wash and dry
  • Please see measurement chart.
  • Regular, standard fitting women’s tee.

Regular standard fit womens style. Please refer to our sizing chart for measurements.

List Price: $ 21.99

Price: $ 13.89

, , , , ,

SDC Nutrition About Time Whey Protein Isolate, Vanilla, 2 Pound

3
by on June 27, 2015 at 11:43 pm

SDC Nutrition About Time Whey Protein Isolate, Vanilla, 2 Pound

SDC Nutrition About Time Whey Protein Isolate, Vanilla, 2 Pound

  • Sweetened with stevia
  • Cold processed, micro filtered 100% whey protein isolate
  • 25 grams of protein per serving

About time’s high quality whey protein isolate keeps it simple and 100% all natural. Sweetened with stevia. Cold processed, micro filtered 100% whey protein isolate. 25 grams of protein per serving.

List Price: $ 48.43

Price: $ 36.86

, , , , , , ,

Testosterone Booster Fat Burner for Men-S-500 All In One Ultra Concentrated Muscle Builder, Pre Work Out, Nitric Oxide Supplement, Fat Burner, Energy Pills, Weight Loss Supplement, 60 Capsules, 30 Day Cycle, Look Great, Feel Great Today

3
by on June 27, 2015 at 8:00 pm

Testosterone Booster Fat Burner for Men-S-500 All In One Ultra Concentrated Muscle Builder, Pre Work Out, Nitric Oxide Supplement, Fat Burner, Energy Pills, Weight Loss Supplement, 60 Capsules, 30 Day Cycle, Look Great, Feel Great Today

Testosterone Booster Fat Burner for Men-S-500 All In One Ultra Concentrated Muscle Builder, Pre Work Out, Nitric Oxide Supplement, Fat Burner, Energy Pills, Weight Loss Supplement, 60 Capsules, 30 Day Cycle, Look Great, Feel Great Today

  • Supports Men’s Healthy Testosterone Levels
  • Burns Fat While Keeping Health Lean Muscle Mass.
  • Ultra Concentrated Capsules with No Fillers or Binders.
  • 30 Day Cycle That Works Great Stacked With T-250.
  • QUALITY and 100% MONEY BACK GUARANTEE-All our products are made in USA GMP Certified Facilities – 100% Money Back Guarantee When you order our S-500 testosterone booster supplement you are protected by a 30 day, quality matters money back guarantee with dedicated customer service to ensure the best experience, Made in

What is S-500?

S-500 is a breakthrough powerful fat burning testosterone booster for men and is designed to transform your body, shrink your belly and achieve total body fitness. Our ultra concentrated lean muscle formula has proven ingredients that deliver your body with what it needs to accomplish your fitness goals and get the shape you really want.

Why is S-500 7x More Powerful Then Average Testosterone Booster?

S-500 works in 3 Unique Ways To

List Price: $ 69.97

Price: $ 19.97

, , , , , , , , , , , , , , , , , , , , ,

One-a-Day Prenatal Multivitamin with Organic Fruits and Veggies PLUS Probiotics & Enzymes from IntraNaturals – The BEST Prenatal w/ the Ideal Combination of Vital Nutrients for You and Your Baby – (Comparable to New Chapter and Rainbow Light) – NON-GMO, Soy & Sugar FREE – One-a-Day – 60 Day Supply – IntraNaturals LIFETIME Guarantee

3
by on June 26, 2015 at 1:03 pm

One-a-Day Prenatal Multivitamin with Organic Fruits and Veggies PLUS Probiotics & Enzymes from IntraNaturals – The BEST Prenatal w/ the Ideal Combination of Vital Nutrients for You and Your Baby – (Comparable to New Chapter and Rainbow Light) – NON-GMO, Soy & Sugar FREE – One-a-Day – 60 Day Supply – IntraNaturals LIFETIME Guarantee

One-a-Day Prenatal Multivitamin with Organic Fruits and Veggies PLUS Probiotics & Enzymes from IntraNaturals - The BEST Prenatal w/ the Ideal Combination of Vital Nutrients for You and Your Baby - (Comparable to New Chapter and Rainbow Light) - NON-GMO, Soy & Sugar FREE - One-a-Day - 60 Day Supply - IntraNaturals LIFETIME Guarantee

  • DAILY NUTRITION FOR MOM AND BABY – A Prenatal is an investment into you and your baby’s future together. A great Prenatal means you get the best nutrients possible to ensure your baby is born the healthiest they can be and given the best start in life possible. IntraNaturals Prenatal Multivitamin is made with love using all natural, vegetarian, Earth-friendly Organic food sources that are non-GMO, soy-free, gluten free, and easy on your stomach to support a healthy pregnancy.
  • 800mcg FOLIC ACID TO SUPPORT VITAL DEVELOPMENT – Folic Acid is one of the most important ingredients in a Prenatal Multivitamin as it is crucial in preventing spinal cord defects in the early development stages of your baby. The USDA (U.S. Department of Agriculture) recommends at least 600mcg of Folic Acid daily for any pregnant or breastfeeding woman. Each tablet of IntraNaturals Prenatal Multivitamin (one serving) contains 800mcg of Folic Acid which more than meets the recommended amount.
  • CONTAINS FRUIT + VEGGIE BLEND AND PROBIOTICS & ENZYMES – Our Organic Fruit + Vegetable Blend is made with organic spinach, kale, blueberries, carrot & more to support you before pregnancy, during, and after, as well as breast health and healthy estrogen levels. Our Probiotics & Enzymes Blend is made with the “good kind” of bacteria to enable a healthy metabolism and immune system.
  • ONE A DAY, EVEN ON AN EMPTY STOMACH – We believe that a Prenatal Multivitamin should be all in one, and not a bother to your daily routine. That’s why we formulated the best seller IntraNaturals Prenatal Multivitamin to pack as many nutrients, vitamins, and minerals into one conveniently sized tablet, not three. Take just one easy to swallow tablet at the same time each day, even on an empty stomach.
  • PROTECTED BY THE INTRANATURALS LIFETIME GUARANTEE – All IntraNaturals products come with our Lifetime Guarantee. If at any point in the future you’re not happy with your order, let our friendly Customer Care Team know and we’ll refund your entire purchase-100% Guaranteed.

Organic Fruit + Vegetable Blend Plus Probiotics & Enzymes: Our Organic Fruit + Vegetable Blend is made with organic spinach, kale, blueberries, carrot & more to support a healthy pregnancy, breast health, and healthy estrogen levels. Our Probiotic & Enzyme Blend is made with the good kind of bacteria to enable a healthy metabolism and immune system. Wholesome Nutrients for a Healthy Pregnancy: When you’re pregnant, every nutrient counts. The IntraNaturals Prenatal Multivitamin contains every be

List Price: $ 59.95

Price: $ 24.95

, , , , , , , , , , , , , , , , , , , , , , , , , ,

Weightlifting Gloves for Gym Fitness Bodybuilding – Workout Gloves for Men & Women – Dominator Leather Crossfit Cross Training Gloves W. Wrist Strap Wrap – Best Weight Lifting Gloves with Wrist Support for Heavy Lifting – 1 Year Replacement Warranty (X-Large)

3
by on June 26, 2015 at 6:16 am

Weightlifting Gloves for Gym Fitness Bodybuilding – Workout Gloves for Men & Women – Dominator Leather Crossfit Cross Training Gloves W. Wrist Strap Wrap – Best Weight Lifting Gloves with Wrist Support for Heavy Lifting – 1 Year Replacement Warranty (X-Large)

Weightlifting Gloves for Gym Fitness Bodybuilding - Workout Gloves for Men & Women - Dominator Leather Crossfit Cross Training Gloves W. Wrist Strap Wrap - Best Weight Lifting Gloves with Wrist Support for Heavy Lifting - 1 Year Replacement Warranty (X-Large)

  • GENUINE SOFT LEATHER – SUPERIOR DURABLE STITCHING – Unbeatable Grip Enhancement – Crown Gear Dominator gloves can significantly improve your grip, allowing you to lift heavier weights, do more reps and meet your goals sooner. The effect is particularly noticeable if you tend to sweat as moisture can make weights slip, even causing injury.
  • 4-WAY STRETCH FABRIC – Provide Multi-Directional Stretching & Comfort – “EZ Pull-off” System for Easy Removal -DOMINATOR gloves are easy to remove and comfortable to wear. Durable and practical, they allow you to work beyond your natural grip limit, so you can work out the muscle groups you’re targeting, not just your hands. Leather panels linked with stretch material give a close fit while allowing ease of movement so these gloves will be comfortable and effective throughout your workout.
  • STRATEGICALLY PADDED – Reduce Pressure & Prevent Calluses and Blisters on Hands – Make your weightlifting workout more comfortable and more effective with premium Crown Gear weightlifting gloves. Made of soft leather with strategic padding, our weightlifting gloves can significantly improve your grip. Cleverly designed to minimise blisters and calluses, these are weightlifting gloves with built-in wrist support.
  • With INTEGRATED WRIST SUPPORT and strategic padding, Crown Gear weightlifting gloves provide protection on all fronts. These gloves are comfortable to wear, easy to get on and off and can prevent blisters and calluses as well as reducing the risk of wrist injury. The sleek black and red design means they look good at the gym. Attention has been paid to every detail.
  • ****1 Year Hassle-Free Replacement Guarantee. Click on the Add to Cart Button to ORDER NOW>>

Crown Gear Dominator Weight Lifting Gloves – Your One Stop Solution to Your Grip, Calluses, Wrist Support Challenges: A premium product Crown Gear weightlifting gloves are easy to remove and comfortable to wear. Durable and practical, they allow you to work beyond your natural grip limit, so you can work out the muscle groups you’re targeting, not just your hands. Leather panels linked with stretch material give a close fit while allowing ease of movement so these gloves will be comfortable a

List Price: $ 65.97

Price: $ 44.95

in Fitness Gear

, , , , , , , , , , , , , , , , , , , , , ,

Garcinia Cambogia – NaturaBest – 100% PURE Garcinia, 60 1000mg Capsules

2
by on June 26, 2015 at 6:02 am

Garcinia Cambogia – NaturaBest – 100% PURE Garcinia, 60 1000mg Capsules

Garcinia Cambogia - NaturaBest - 100% PURE Garcinia, 60 1000mg Capsules

  • Proven To Be An All Natural, Completely Safe and Effective Weight Loss Supplement, Non Stimulating.
  • 100% Pure NaturaBest Garcinia Cambogia Extract Featuring The Dr. Oz Recommended 50% HCA and Calcium and Potassium for Optimum Efficiency.
  • Features 60, 1000mg Capsules, Most Competitors Only Have 500mg This Requires You To Take Double The Amount Of Capsules Per Serving.
  • Made In The USA In An FDA Approved Facility, Help Support A US Based Company Who Puts Their Customers First.
  • Clinically Proven To Supress Appetite, Block Fat From Metabolizing, Increases Fat Loss by 3 Times More Than Diet And Exercise Alone, and Promotes Healthy Serotonin Levels And Energy

NaturaBest Garcinia Cambogia Extract

Garcinia Cambogia is extract from the South East Asian fruit Garcinia Gummi-Gatta, part of the tamarind family. It is an all natural extract shown to suppress your appetite, burn fat while maintaining your lean muscle mass, and increase fat loss 3 times more than diet and exercise alone. Garcinia Cambogia has also been proven to increase serotonin levels and has all of these positive effects without negative side effects.

What Does Garcinia D

List Price: $ 49.99

Price: $ 35.43

, , , , , ,

thinkThin High Protein, Chunky Peanut Butter, 2.1 Ounce (Pack of 10)

3
by on June 26, 2015 at 2:44 am

thinkThin High Protein, Chunky Peanut Butter, 2.1 Ounce (Pack of 10)

thinkThin High Protein, Chunky Peanut Butter, 2.1 Ounce (Pack of 10)

  • This high protein bar packs the nutty flavors of chunky roasted peanut butter blended with cocoa and covered in luscious milk chocolate.
  • 20g of protein with 0g of sugar
  • Gluten free and low glycemic
  • 2.1 ounce/60g bars (pack of 10)

thinkThin High Protein Bars thinkThin High Protein Bars offer a portable, nutritious snack to help satisfy hunger. The gluten-free bars contain 20 grams of protein, 0 grams of sugar and are certified low glycemic, so you can look and feel your best through long days. Perfect for a sweet treat on-the-go or a delicious afternoon pick-me-up, thinkThin High Protein Bars contain a balanced mix of quality ingredients covered in decadent chocolate, providing an indulgent taste with none of the gu

List Price: $ 23.20

Price: $ 15.99

, , , , , , ,

Vita Bully Supplement for Bully Breeds: Pit Bulls, American Bullies, Exotic Bullies, Bulldogs, Pocket Bullies (60 Tablets)

2
by on June 26, 2015 at 2:18 am

Vita Bully Supplement for Bully Breeds: Pit Bulls, American Bullies, Exotic Bullies, Bulldogs, Pocket Bullies (60 Tablets)

Vita Bully Supplement for Bully Breeds: Pit Bulls, American Bullies, Exotic Bullies, Bulldogs, Pocket Bullies (60 Tablets)

  • This stuff works & works great! A daily, healthy multivitamin to give to your bully.
  • Boost Muscle Growth & Repair with Amino Acids.
  • Builds Energy, Creates A Shiny Coat, Great for Strength & Color in Nails.
  • Perfect for Puppies, Builds a stronger Immune system, Taste Great!
  • 100% Safe, Veterinarian Approved & No Side Effects (Just a Healthy Pet)

Are you looking for a daily nutritional supplement to give your bully dog that will help it live a healthier, stronger, happier life? A nutritional product that will help your dog have more energy and maintain a strong immune system helping it fight off sickness easier? A healthy dog is a happy dog which can add years to their life. Sometimes the food we feed our dogs don’t supply enough or have the proper nutrients that their body needs to establish this goal. Just as humans do, we supplement o

List Price: $ 24.99

Price: $ 24.99

, , , , , , , , , ,

Muscletech Cell Tech Limited Edition, Lemonade Ice Tea, 3.09 LBS

2
by on June 25, 2015 at 11:55 am

Muscletech Cell Tech Limited Edition, Lemonade Ice Tea, 3.09 LBS

Muscletech Cell Tech Limited Edition, Lemonade Ice Tea, 3.09 LBS

  • Ultimate hard gainer creatine formula
  • More muscle size and fullness
  • Cell-volumizing amino acids
  • Enhanced nutrient transport
  • Best-in-class taste

Cell tech limited edition 3 lb lemonade ice tea. Ultimate hard gainer creatine formula. More muscle size and fullness. Cell-volumizing amino acids.

List Price: $ 47.99

Price: $ 23.44

, , , , , ,

Promax Protein Bar, Cookies ‘n Cream, 2.64 Ounce, 12-Pack

3
by on June 24, 2015 at 5:45 am

Promax Protein Bar, Cookies ‘n Cream, 2.64 Ounce, 12-Pack

Promax Protein Bar, Cookies 'n Cream, 2.64 Ounce, 12-Pack

  • Box of 12 bars; 75g each
  • 20g of replenishing protein, 18 vitamins and minerals, and great tasting flavors
  • Certified Gluten-Free, Kosher and Vegetarian
  • Use Promax bars pre-activity for energy and post-activity for recovery
  • No artificial sweeteners or preservatives, high fructose corn syrup, maltitol or gelatin

Promax packs its energy bars with 20 grams of replenishing protein, 18 vitamins and minerals, and great tasting flavors. You won’t find any artificial sweeteners or preservatives, high fructose corn syrup, trans fats, maltitol or gelatin in Promax Bars. Gluten-free, kosher and vegetarian. Promax is protein for the people.

List Price: $ 17.49

Price: $ 15.89

, , , , , ,

Black Gym Body Building Training Fitness Gloves Sports Weight Lifting Gloves Exercise Cycling For Men And Women Fitness Sports Half Finger Gloves GYM Weight Lifting Wraps Body Building Workout Exercise Training Absorbing Sport Mitts Fitness Sports Half Finger Gloves GYM Weight Lifting Wraps Body Building Workout Exercise Training Absorbing Sport Mitts

1
by on June 23, 2015 at 9:18 pm

Black Gym Body Building Training Fitness Gloves Sports Weight Lifting Gloves Exercise Cycling For Men And Women Fitness Sports Half Finger Gloves GYM Weight Lifting Wraps Body Building Workout Exercise Training Absorbing Sport Mitts Fitness Sports Half Finger Gloves GYM Weight Lifting Wraps Body Building Workout Exercise Training Absorbing Sport Mitts

Black Gym Body Building Training Fitness Gloves Sports Weight Lifting Gloves Exercise Cycling For Men And Women Fitness Sports Half Finger Gloves GYM Weight Lifting Wraps Body Building Workout Exercise Training Absorbing Sport Mitts Fitness Sports Half Finger Gloves GYM Weight Lifting Wraps Body Building Workout Exercise Training Absorbing Sport Mitts

  • With the half-finger design, they allow your hands to breath comfortably, keeping you cool and dry
  • Half-finger design enhances natural feel, they are not bulky and awkward like other gloves
  • Abrasion resistant leather on the palm maximizes glove wear
  • Suitable for driving, barbell, dumbbell, rowing, weightlifting, tug-of-war, and various kinds of sports fitness.
  • 9~13 days to arrive by USPS with tracking No. fast shipping

Item Features: The gloves are designed specially for sports lovers Specially designed to provide comfortable compression and support Fingerless design, thumb and knuckle can bend naturally With the half-finger design, they allow your hands to breath comfortably, keeping you cool and dry Half-finger design enhances natural feel, they are not bulky and awkward like other gloves Abrasion resistant leather on the palm maximizes glove wear Suitable for driving, barbell, dumbbell, rowing, weightliftin

List Price: $ 12.80

Price: $ 3.60

in Fitness Gear

, , , , , , , , , , , , , , , , , ,

Top Rated Klamath Blue Green Algae – More Effective Than Spirulina or Chlorella – Grown From The Clean Pure Source Of Klamath Lake, 500mg 60ct Gel Capsules By BRI Nutrition

2
by on June 23, 2015 at 8:00 pm

Top Rated Klamath Blue Green Algae – More Effective Than Spirulina or Chlorella – Grown From The Clean Pure Source Of Klamath Lake, 500mg 60ct Gel Capsules By BRI Nutrition

Top Rated Klamath Blue Green Algae - More Effective Than Spirulina or Chlorella - Grown From The Clean Pure Source Of Klamath Lake, 500mg 60ct Gel Capsules By BRI Nutrition

  • ★WHY US: One of the biggest complaints we hear is about the low quality Blue Green Algae products on the market today. We decided we should source the best ingredients and sell them at a reasonable price. Our Klamath Blue Green Algae Superfood 500mg is more efffective than Spirulina or Chlorella. Grown from the fresh clean and pure mountain sun source Of Klamath Lake not some aquarium.
  • ★WHAT IT IS: A high protein raw dietary supplement powder extract plus in the form of 500 mg super foods capsules. Great for any healthy person wanting a balance of life recommended by Dr. around the world. Sourced from right in the US not from other places like India, Japan, Korea or Taiwan. Great as a detox cleanser or for weight loss, increase energy, fight diabetes and improve overall health. Safe for men, women & kids. More effective than Spirulina or Chlorella!
  • ★PURITY: 100% safe and natural. No fillers or artificial ingredients. We use only the very best, scientifically-tested ingredients, all of which are manufactured in our US, FDA-inspected, state-of-the-art, facility, with strict adherence to good manufacturing practices. Every batch is third party tested to ensure that we only utilize ingredients that are safe and pure. OUR GUARANTEE: We’re very confident that you’ll love this product that we offer a 100% money-back guarantee.
  • ★COMMON NAMES: There are so many different ways that people try and spell or even pronounce Klamath Blue Green Algae. Just to set the record straight its CLAM-ATH. Here are some common mis-spellings: yaeyama, ojio, kyoto, febico, pyrenoidosa, afa, alage, aphanizomenon, flos-aquae, alga, algai, algal, algea, arthrospira, platensis, kelp, manna, mana, kyoto, onnit and finally gaia. No Matter what you call it, you already know the amazing benefeits from blue green algae.
  • ★SHARE:Consider ordering one bottle for yourself and another for a friend or loved one. Keep each other motivated and reach your goals together and more quickly. BRI Nutrition stands by every quality product they make. We manufacture only premium and extra pure but high potency vitamins, capsules, pills, tablets, powders, multivitamins, supplements, topical creams, liquids, serums, vegan foods, and natural organic-based extracts for men, women, and children. Check BRINutrition out today!

★★★★★Long-time blue-green algae user Cosmo Cavallaro had this to say about BRI’s Klamath blend: I have been eating BGA for over 3 decades and know the benefits. I have been eating BRI Nutrition’s BGA for the past 6 months and can confirm that it is a consistently quality harvest. The air drying process that is used is very important and the fact that they DO NOT contain fillers or artificial ingredients. The Algae is harvested from Upper Klamath Lake in Oregon in a volcanic-ash sedimen

List Price: $ 49.99

Price: $ 13.88

, , , , , , , , , , , , , , , , , , ,

Nature’s Best Zero Carb Isopure, Creamy Vanilla, 7.5-Pound Tub

2
by on June 23, 2015 at 12:04 pm

Nature’s Best Zero Carb Isopure, Creamy Vanilla, 7.5-Pound Tub

Nature's Best Zero Carb Isopure, Creamy Vanilla, 7.5-Pound Tub

  • Contains 100% Ion Exchange Whey Protein Isolate
  • Lactose free, fat free, glutamine enriched carbohydrate free protein supplement
  • All impurities typically found in whey proteins have been removed

Lean Mean Carb Free Machines50 grams of 100% pure whey protein isolate and not a carb in sight. And it still comes with glutamine and nutrients, but no lactose or impurities, so it’s easy to drink. Your gut will agree.

List Price: $ 160.00

Price: $ 95.94

, , , , , , ,

Top Quality Probiotics Supplement 20 Billion CFUs – 60 Capsules – Boosts the Immune System « Buy 3 & 1 is FREE when using code PROB3G1F at Checkout » No Refrigeration Required – Clinically Proven and Developed by Doctors – Guaranteed Potency until Expiration Date – High-Quality Strains Survive Stomach Acid – All-Natural Formula Promotes Optimal Health and Helps Weight Loss – Promotes Colon and Digestion Health. Independently Tested & Verified. No Side Effects, Safe for Everyday Use – Shelf-Stable – 100% Money Back Guarantee

3
by on June 23, 2015 at 2:00 am

Top Quality Probiotics Supplement 20 Billion CFUs – 60 Capsules – Boosts the Immune System « Buy 3 & 1 is FREE when using code PROB3G1F at Checkout » No Refrigeration Required – Clinically Proven and Developed by Doctors – Guaranteed Potency until Expiration Date – High-Quality Strains Survive Stomach Acid – All-Natural Formula Promotes Optimal Health and Helps Weight Loss – Promotes Colon and Digestion Health. Independently Tested & Verified. No Side Effects, Safe for Everyday Use – Shelf-Stable – 100% Money Back Guarantee

Top Quality Probiotics Supplement 20 Billion CFUs - 60 Capsules - Boosts the Immune System « Buy 3 & 1 is FREE when using code PROB3G1F at Checkout » No Refrigeration Required - Clinically Proven and Developed by Doctors - Guaranteed Potency until Expiration Date - High-Quality Strains Survive Stomach Acid - All-Natural Formula Promotes Optimal Health and Helps Weight Loss - Promotes Colon and Digestion Health. Independently Tested & Verified. No Side Effects, Safe for Everyday Use - Shelf-Stable - 100% Money Back Guarantee

  • THE AMAZING HEALTH BENEFITS OF PROBIOTICS HAVE BEEN FEATURED ON THE DR. OZ SHOW Dr. Oz, recommends a daily dose of high-quality probiotics to repopulate the good bacteria in the body, which are usually destroyed through dieting and taking antibiotics.
  • EACH LOT IS EXTENSIVELY TESTED AND THIRD-PARTY CERTIFIED The potency, purity, and content of each batch of probiotics are extensively analyzed by professionals before its release. The ingredients in our products are 100% natural, and we use no binders or fillers of any sort. All of Schwartz Bioresearch’s supplements are third party tested for potency and purity, and are manufactured in the USA, in an FDA-approved facility under strict GMP guidelines.
  • PROBIOTICS CAN HELP YOU LOSE WEIGHT Adding 2 capsules a day of our probiotic supplement can further benefit your health in ways you would not believe! Weight loss and fat loss are, more often than not, added bonuses of taking probiotics regularly.
  • NOT ALL PROBIOTICS ARE CREATED EQUAL. WE GUARANTEE POTENCY FOR ENTIRE SHELF LIFE! Most probiotics marketed online are weak strains that don’t survive the shipping and storing processes, let alone stomach acids and bile! Some manufactures are even offering probiotics with a coating full of chemicals so the weak strains won’t die in the stomach. We are some of the very few who can guarantee potency, until the expiration date, the strength of our probiotic lies in the high-quality strains we work with, not in artificial coatings.
  • GREAT HEALTH BENEFITS Some of the many benefits of probiotics include: the increased production of vitamins, relief from allergies, gas, bloating, and constipation, and increased absorption of calcium for better bone density. Two capsules a day can even help you get rid of digestive problems related to IBS or lactose intolerance. Around 80% of our immune system is in our stomach, and when probiotics abound in our bodies, they make it harder for bacteria to settle in, thus boosting your immune system.

Want to Improve your digestion, boost your immune system and lose weight in the process? Try our Superior Probiotics Supplement 20 Billion CFUs!
*** Our High-Quality Strains Survive Stomach Acid & Bile Fluids ***
* SUPPORTS Digestive Health
* RESTORES Natural Balance
* BOOSTS Immune System
* PROMOTES regularity
80% of our immune system is in our gut and our gluten free Superior Probiotics helps you to keep it in optimal condition.
*Top notch technology. Certified potency. B

List Price: $ 54.95

Price: $ 19.95

, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,

BodyTech – Creatine Monohydrate 100% Pure, 5 gm , 18 oz powder

2
by on June 22, 2015 at 11:56 pm

BodyTech – Creatine Monohydrate 100% Pure, 5 gm , 18 oz powder

BodyTech - Creatine Monohydrate 100% Pure, 5 gm , 18 oz powder

Lean Muscle Mass Volumizer

List Price: $ 13.99

Price: $ 13.99

, , , , ,

Quest Nutrition Protein Powder Chocolate Milkshake, 2 Pound

3
by on June 22, 2015 at 8:43 am

Quest Nutrition Protein Powder Chocolate Milkshake, 2 Pound

Quest Nutrition Protein Powder Chocolate Milkshake, 2 Pound

  • Delicious Chocolate Milkshake
  • New delicious formula, 1g of sugar
  • Tastes great even with water

Great for shakes, baking & cooking. Less than 1g sugar per serving. No Soy. No Added Sugar. Gluten Free. Taste, Reimagined. Quest Protein Powder is a tasty, decadent blend. Even when it’s simply mixed with water.

List Price: $ 59.99

Price: $ 26.00

, , , , , ,

G970 Golds Gym Drawstring Gym Bag (Black)

1
by on June 21, 2015 at 12:17 pm

G970 Golds Gym Drawstring Gym Bag (Black)

G970 Golds Gym Drawstring Gym Bag (Black)

  • Golds Gym Circle logo screen-print
  • Dual Closure Rope Openings
  • Steel Washer Rope Anchors
  • 17.5″-L X 14″-H

A handy lightweight gym bag with a drawstring rope closure. Featuring the Golds Gym circle logo screen-printed on the side of the gym back.

List Price: $ 12.95

Price: $ 9.95

in Fitness Gear

, , ,

CLA, High Potency Conjugated Linoleic Acid Pills Made from Safflower Extract, Weight Loss Supplement for Women and Men, Appetite Suppressant, Burns Belly Fat, Highest Strength Thermogenic Burner to Lose Weight & Increase Lean Muscle – 120 Softgels

3
by on June 21, 2015 at 12:00 pm

CLA, High Potency Conjugated Linoleic Acid Pills Made from Safflower Extract, Weight Loss Supplement for Women and Men, Appetite Suppressant, Burns Belly Fat, Highest Strength Thermogenic Burner to Lose Weight & Increase Lean Muscle – 120 Softgels

CLA, High Potency Conjugated Linoleic Acid Pills Made from Safflower Extract, Weight Loss Supplement for Women and Men, Appetite Suppressant, Burns Belly Fat, Highest Strength Thermogenic Burner to Lose Weight & Increase Lean Muscle - 120 Softgels

  • CONJUGATED LINOLEIC ACID BURNS FAT! CLA is a fatty free acid that occurs naturally in meat and dairy, but in quantities too small to be effective for weight loss. CLA increases the rate of your metabolism, encourages muscle growth and even lowers insulin resistance. By increasing the amount of CLA your body consumes, medical studies show that there is more of a chance that your body fat will be reduced. Most progress is made in the abdominal region.
  • SPEEDS UP THE FAT BURNING PROCESS! CLA naturally promotes the rapid production of lean tissue when combined with a nutritious diet. CLA helps shrink the size of belly fat cells by increasing your metabolic rate. This causes your body to work faster, and therefore burn calories much more quickly. The average person taking CLA can see results in just four weeks.
  • CLA WITH SAFFLOWER OIL! Safflower oil produces more CLA than alternatives such as sunflower oil. Each Earths Design CLA 1000 Mg softgel contains 78% CLA from safflower oil.
  • PROMOTES MUSCLE GROWTH! CLA is known to promote muscle growth and again, this helps burn fat. Muscles need more energy than fat, therefore you burn more calories than usual.
  • PURITY & POTENCY! We use the best, scientifically-tested ingredients. They are manufactured in the USA, in state-of-the-art facilities, with strict adherence to good manufacturing practices. All our products are Third Party Tested for potency & purity.

Conjugated linoleic acid (CLA) is a polyunsaturated fatty acid naturally found in beef and dairy products. Most CLA dietary supplements are made from safflower oil. Results from well-designed clinical trials suggest that CLA may reduce body fat mass.* Conjugated linoleic acid (CLA) is a polyunsaturated fatty acid that has become a popular weight management supplement because of its potential ability to reduce body fat.* The active ingredient in our formula is natural and non-stimulating, making

List Price: $ 49.99

Price: $ 22.99

, , , , , , , , , , , , , , , , , , , , , , , , , ,

Nature Made Vitamin C 500mg with Rose Hips, (130 Tablets)

3
by on June 21, 2015 at 2:59 am

Nature Made Vitamin C 500mg with Rose Hips, (130 Tablets)

Nature Made Vitamin C 500mg with Rose Hips,  (130 Tablets)

  • Recommended as part of daily regimen for winter wellness and immunity
  • Aids in proper function of immune system
  • Offers antioxidant benefits for lungs and lens of the eye
  • 1 bottle, contains 130 tablets
  • null

Nature Made Vitamin C 500mg w/ Rose Hips 3-pack/130-count

List Price: $ 9.99

Price: $ 2.00

, , , , , ,

Creatine kinase M-type protein (10ug)

0
by on June 20, 2015 at 11:54 am

Creatine kinase M-type protein (10ug)

Creatine kinase M-type protein (10ug)

  • High-Quality Protein
  • Shipped with Protein Data Information Sheet
  • Multiple Quantities Available
  • Please Request Further Information If Needed

Homo sapiens (Human) His tag protein expressed from E.coli Sequence: DLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPA

List Price: $ 299.20

Price: $ 299.20

, , , ,

Sponsor

Bad Behavior has blocked 390 access attempts in the last 7 days.